PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00423.1.p
Common NameEUGRSUZ_B00423, LOC104419057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 316aa    MW: 35758.4 Da    PI: 4.5514
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00423.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.82.1e-1983136356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k++++t eq++ Le+ Fe ++++  +++ +LAk lgL+ rqV +WFqNrRa++k
  Eucgr.B00423.1.p  83 KKRRLTVEQVQFLEKSFEVENKLEPDRKIQLAKDLGLQPRQVAIWFQNRRARWK 136
                       56789************************************************9 PP

2HD-ZIP_I/II127.17.4e-4182172191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       ekkrrl+ eqv++LE+sFe e+kLep+rK +la++Lglqprqva+WFqnrRAR+ktkqlEkdye+L++++++lk++ ++L ke ++L++e+
  Eucgr.B00423.1.p  82 EKKRRLTVEQVQFLEKSFEVENKLEPDRKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYETLQASFNTLKSDYDTLIKERNDLKAEV 172
                       69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-2070140IPR009057Homeodomain-like
PROSITE profilePS5007117.32978138IPR001356Homeobox domain
SMARTSM003891.2E-1981142IPR001356Homeobox domain
CDDcd000861.01E-1783139No hitNo description
PfamPF000461.1E-1683136IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1985145IPR009057Homeodomain-like
PRINTSPR000311.3E-5109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5118134IPR000047Helix-turn-helix motif
PfamPF021832.8E-14138179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MAGGASASAS AITTLLQNQR VPPPPPSDAF FLSGSSPFLG SRAMVSFEDA HRGNRLNRPF  60
FRSIDPDENG EDDLEDYFHQ PEKKRRLTVE QVQFLEKSFE VENKLEPDRK IQLAKDLGLQ  120
PRQVAIWFQN RRARWKTKQL EKDYETLQAS FNTLKSDYDT LIKERNDLKA EVLNLTDKLL  180
HKGNEKESSE SSSKSSQGLF QNPIADSVSE DEVSRVPIPT WPEDICSVKS DMFDSESPHY  240
TDAAHSSLLE PGDSSYAFEP DHSDLSQDEE DNLSKSLLST RNYPKLENSD YAILPPNSCN  300
FGFHAEDPAF WPWSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00423.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028877.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
TrEMBLA0A059CYV10.0A0A059CYV1_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s07640.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-44homeobox 1